This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SLC22A2 Polyclonal Antibody
catalog :
PA5-80015
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
Reference
Gulsun T, Ucar B, Sahin S, Humpel C. The Organic Cation Transporter 2 Inhibitor Quinidine Modulates the Neuroprotective Effect of Nerve Growth Factor and Memantine on Cholinergic Neurons of the Basal Nucleus of Meynert in Organotypic Brain Slices. Pharmacology. 2021;106:390-399 pubmed publisher
product information
Product Type :
Antibody
Product Name :
SLC22A2 Polyclonal Antibody
Catalog # :
PA5-80015
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Organic cation transporters (OCT) are expressed in the plasma membrane of epithelial cells from a wide range of tissues, where they function in the elimination of endogenous amines, cationic drugs and other xenobiotics. The structure of OCTs consists of a 12-transmembrane-domain structure and a large extracellular hydrophilic loop. In humans, OCT1 is primarily expressed in the liver, while OCT2 is expressed in the kidney. OCT3 is expressed in the placenta, skeletal muscle, prostate, aorta and liver. OCT2, also known as SLC22A2, is a multi-specific transporter protein localizing to the basolateral and luminal membranes of the kidney distal tubule and proximal tubules. OCT2 is responsible for mediating the pH-sensitive tubular uptake of organic compounds from circulation. An additional splice variant exists for OCT2, namely OCT2-A.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2-Oct; hOCT2; OCT2; OCT2r; Orct2; Organic cation transporter 2; rOCT2; Slc22a2; solute carrier family 22 (organic cation transporter), member 2; solute carrier family 22 member 2; solute carrier family 22, member 2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA