SFTPA1/SFTPA2 Polyclonal Antibody | Invitrogen PA5-79987 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SFTPA1/SFTPA2 Polyclonal Antibody

catalog :

PA5-79987

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

citations: 1

Reference
Remex N, Abdullah C, Aishwarya R, Nitu S, Traylor J, Hartman B, et al. Sigmar1 ablation leads to lung pathological changes associated with pulmonary fibrosis, inflammation, and altered surfactant proteins levels. Front Physiol. 2023;14:1118770 pubmed publisher

product information

Product Type :

Antibody

Product Name :

SFTPA1/SFTPA2 Polyclonal Antibody

Catalog # :

PA5-79987

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 45 ng/mL in healthy individuals.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)