This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
RRM2 Polyclonal Antibody
catalog :
PA5-79937
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
product information
Product Type :
Antibody
Product Name :
RRM2 Polyclonal Antibody
Catalog # :
PA5-79937
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
RRM2 is one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the protein (M2) is regulated in a cell-cycle dependent fashion.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AA407299; R2; ribonucleoside-diphosphate reductase M2 chain; ribonucleoside-diphosphate reductase subunit M2; Ribonucleotide reductase 2; ribonucleotide reductase M2; ribonucleotide reductase M2 polypeptide; ribonucleotide reductase regulatory subunit M2; ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RR2; RR2M; RRM2; RRR2M
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments