This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
c-Rel Polyclonal Antibody
catalog :
PA5-79922
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
c-Rel Polyclonal Antibody
Catalog # :
PA5-79922
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA., RELB (604758), NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (Belguise and Sonenshein, 2007).
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
BCD541; C-Rel; C-Rel protein; C-Rel proto-oncogene protein; gemin 1; gemin-1; LOW QUALITY PROTEIN: proto-oncogene c-Rel; oncogene REL, avian reticuloendotheliosis; proto-oncogene c-Rel; REL; REL proto-oncogene, NF-kB subunit; reticuloendotheliosis oncogene; SMA; SMA1; SMA2; SMA3; SMA4; SMN; SMN2; SMNT; v-rel avian reticuloendotheliosis viral oncogene homolog; v-rel reticuloendotheliosis viral oncogene homolog
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA