c-Rel Polyclonal Antibody | Invitrogen PA5-79922 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

c-Rel Polyclonal Antibody

catalog :

PA5-79922

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

c-Rel Polyclonal Antibody

Catalog # :

PA5-79922

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA., RELB (604758), NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (Belguise and Sonenshein, 2007).

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

BCD541; C-Rel; C-Rel protein; C-Rel proto-oncogene protein; gemin 1; gemin-1; LOW QUALITY PROTEIN: proto-oncogene c-Rel; oncogene REL, avian reticuloendotheliosis; proto-oncogene c-Rel; REL; REL proto-oncogene, NF-kB subunit; reticuloendotheliosis oncogene; SMA; SMA1; SMA2; SMA3; SMA4; SMN; SMN2; SMNT; v-rel avian reticuloendotheliosis viral oncogene homolog; v-rel reticuloendotheliosis viral oncogene homolog