PTP4A2 Polyclonal Antibody | Invitrogen PA5-79893 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

PTP4A2 Polyclonal Antibody

catalog :

PA5-79893

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

PTP4A2 Polyclonal Antibody

Catalog # :

PA5-79893

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Rat

Isotype :

IgG

Storage :

-20 C

Description :

PRL-2, also known as Protein tyrosine phosphatase 4a2 (Ptp4a2) is a unique nuclear protein tyrosine phosphatase (PTP) that plays a central role in regulating diverse cellular processes. PRL-1 is induced in mitogen-stimulated cells and regenerating liver. PRL-2 exhibits 87% identity to PRL-1 in their amino acid sequences. All mouse PRL proteins contain a C-terminal consensus sequence for prenylation. All PRL proteins bear significant sequence homology to Cdc14p and the tumor suppressor PTEN/MMAC1. PRL-2 is preferentially expressed in skeletal muscle. PRL-2 is also expressed at lower levels in other tissues.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

BM-008; HH13; HH7-2; HU-PP-1; OV-1; phosphatase of regenerating liver 2; PRL2; PRL-2; protein tyrosine phosphatase 4a2; protein tyrosine phosphatase IVA; protein tyrosine phosphatase IVA2; protein tyrosine phosphatase type IVA 2; protein tyrosine phosphatase type IVA, member 2; protein-tyrosine phosphatase 4a2; Protein-tyrosine phosphatase of regenerating liver 2; PTP(CAAXII); PTP4A; Ptp4a2; PTPCAAX2; ptp-IV1a; ptp-IV1b; tyrosine-phosphatase