This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PSMA4 Polyclonal Antibody
catalog :
PA5-79891
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
PSMA4 Polyclonal Antibody
Catalog # :
PA5-79891
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen :
NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYT
Q).
A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
C9; HC9; HsT17706; LOW QUALITY PROTEIN: proteasome subunit alpha type-4; macropain subunit C9; MGC111191; MGC12467; MGC24813; Multicatalytic endopeptidase complex subunit C9; multicatalytic proteinase subunit L; proteasome (prosome, macropain) subunit, alpha type 4; proteasome (prosome, macropain) subunit, alpha type, 4; proteasome 20S subunit alpha 4; proteasome alpha 4 subunit; proteasome component C9; proteasome subunit alpha 4; proteasome subunit alpha type-4; proteasome subunit alpha type-4-like protein; proteasome subunit HC9; proteasome subunit L; PSC9; PSMA 4; PSMA4; QtsA-10816; unnamed protein product; wu:fe05d10; zgc:56176
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA