This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
DARPP-32 Polyclonal Antibody
catalog :
PA5-79859
quantity :
100 ug
price :
US 424.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
DARPP-32 Polyclonal Antibody
Catalog # :
PA5-79859
Quantity :
100 ug
Price :
US 424.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
DARPP-32 is a dopamine (DA) and AMP-regugated ~32 kDa phosphoprotein that is associated with dopaminoceptive neurons. The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regugation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and ProzacĀ®.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AU040756; DARPP32; DARPP-32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; Ppp1r1b; PPR1B; protein pho; protein phosphatase 1 regulatory inhibitor subunit 1B; protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA