This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MYPT1 Polyclonal Antibody
catalog :
PA5-79857
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
MYPT1 Polyclonal Antibody
Catalog # :
PA5-79857
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Non-human primate, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Non-human primate, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP. RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.
Immunogen :
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFD
D).
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa
D).
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments