This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PIK3CB Polyclonal Antibody
catalog :
PA5-79821
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
PIK3CB Polyclonal Antibody
Catalog # :
PA5-79821
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
PIK3CB (phosphatyidylinositol 4,5-biphosphate 3-kinase catalyic subunit beta isoform) is a phosphoinositide-3-kinase that phosphorylates PtdIns (phosphatidylinositol), PtdIns4P (phosphatidylinositol 4-phosphate), and PtdIns(4,5)P2 (phosphatidylinositol 4,5-biphosphate) to generate phosphatidylinositol 3,4,5-triphosphate (PIP3). PIP3 plays a key role in recruiting PH domain-containing proteins to the membrane and activating signaling cascades involved in cell growth, survival, proliferation, motility, and morphology.
Immunogen :
DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQAL
LQIW).
A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa
LQIW).
A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
1110001J02Rik; AI447572; catalytic phosphatidylinositol 3-kinase beta; p110beta; phosphatidylinositol 3-kinase catalytic subunit beta isoform; phosphatidylinositol 3-kinase, catalytic subunit, beta isoform; phosphatidylinositol 3-kinase, catalytic, beta polypeptide; phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta; phosphoinositide-3-kinase, catalytic, beta polypeptide; PI3K; PI3Kbeta; PI3K-beta; pi3kcb; PI3-kinase p110 subunit beta; PI3-kinase subunit beta; PIK3C1; Pik3cb; PtdIns-3-kinase p110; ptdIns-3-kinase subunit beta; ptdIns-3-kinase subunit p110-beta
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments