This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PDPK1 Polyclonal Antibody
catalog :
PA5-79801
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
PDPK1 Polyclonal Antibody
Catalog # :
PA5-79801
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
PDPK1 (3 Phosphoinositide Dependent Protein Kinase 1) phosphorylates AGC kinases. PDPK1 activates conventional PKC and PKC zeta through phosphorylation of critical threonine residues in the activation loop. PDPK1 also phosphorylates Protein Kinase B (PKB) at threonine 308 in the presence of phosphatidylinositol-3,4,5-trisphosphate. Active Akt inactivates Glycogen Synthase Kinase 3 (GSK3), eventually leading to the dephosphorylation and activation of glycogen synthase, and the stimulation of glycogen synthesis. Because of the role that PDPK1 plays in insulin-induced glycogen synthesis and PKC activation, it is a potentially important target for metabolic drug research.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
3-phosphoinositide dependent protein kinase 1; 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; 3-phosphoinositide-dependent protein kinase 2 pseudogene; HGNC:8809; hPDK1; isoenzyme 1; kinase isoenzyme 1; lipoamide; mPDK1; OTTHUMP00000174525; OTTHUMP00000205076; PDK1; PDPK1; PDPK2; PDPK2P; Pkb kinase; PkB kinase like gene 1; PkB-like 1; PRO0461; Protein kinase B kinase
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA