This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PDK4 Polyclonal Antibody
catalog :
PA5-79800
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
citations: 1
product information
Product Type :
Antibody
Product Name :
PDK4 Polyclonal Antibody
Catalog # :
PA5-79800
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
PDK4 (PDHK4), along with the other PDHKs, regulates glucose metabolism by phosphorylating the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex. Inhibition of PDHKs is viewed as a potential therapeutic treatment for type II diabetes. This protein is located in the matrix of the mitrochondria and it's expression is regulated by glucocorticoids, retinoic acid and insulin. PDK4 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial; AV005916; kinase isozyme 4; lipoamide; PDHK4; Pdk4; pyruvate dehydrogenase; pyruvate dehydrogenase kinase 4; Pyruvate dehydrogenase kinase isoform 4; pyruvate dehydrogenase kinase, isoenzyme 4; pyruvate dehydrogenase kinase, isozyme 4; pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial; pyruvate dehydrogenate kinase 4
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments