PDK4 Polyclonal Antibody | Invitrogen PA5-79800 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

PDK4 Polyclonal Antibody

catalog :

PA5-79800

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot

citations: 1

Reference
Léger T, He B, Azarnoush K, Jouve C, Rigaudière J, Joffre F, et al. Dietary EPA Increases Rat Mortality in Diabetes Mellitus, A Phenomenon Which Is Compensated by Green Tea Extract. Antioxidants (Basel). 2019;8: pubmed publisher

product information

Product Type :

Antibody

Product Name :

PDK4 Polyclonal Antibody

Catalog # :

PA5-79800

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Rat

Isotype :

IgG

Storage :

-20 C

Description :

PDK4 (PDHK4), along with the other PDHKs, regulates glucose metabolism by phosphorylating the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex. Inhibition of PDHKs is viewed as a potential therapeutic treatment for type II diabetes. This protein is located in the matrix of the mitrochondria and it's expression is regulated by glucocorticoids, retinoic acid and insulin. PDK4 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN).

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial; AV005916; kinase isozyme 4; lipoamide; PDHK4; Pdk4; pyruvate dehydrogenase; pyruvate dehydrogenase kinase 4; Pyruvate dehydrogenase kinase isoform 4; pyruvate dehydrogenase kinase, isoenzyme 4; pyruvate dehydrogenase kinase, isozyme 4; pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial; pyruvate dehydrogenate kinase 4