This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
EBP1 Polyclonal Antibody
catalog :
PA5-79779
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
EBP1 Polyclonal Antibody
Catalog # :
PA5-79779
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.
Immunogen :
RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHS
FN).
A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
38kDa; AA672939; Cell cycle protein p38-2G4 homolog; Ebp1; ErbB-3 binding protein 1; ErbB3-binding protein 1; ErbB3-binding protein Ebp1; hG4 1; hG4-1; IRES-specific cellular trans-acting factor 45 kDa; ITAF45; MGC81621; MGC94070; Mpp1; p38 2G4; p38-2G4; Pa2g4; Plfap; proliferation-associated 2G4; proliferation-associated 2G4, 38kD; proliferation-associated 2G4, 38kDa; proliferation-associated protein 1; Proliferation-associated protein 2G4; protein p38-2G4; si:dz150i12.2; wu:fb19b11; wu:ft56d05; zgc:86732
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA