NR3C2 Polyclonal Antibody | Invitrogen PA5-79761 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

NR3C2 Polyclonal Antibody

catalog :

PA5-79761

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry

citations: 1

Reference
von M xe4 ssenhausen A, Zamora Gonzalez N, Maremonti F, Belavgeni A, Tonnus W, Meyer C, et al. Dexamethasone sensitizes to ferroptosis by glucocorticoid receptor-induced dipeptidase-1 expression and glutathione depletion. Sci Adv. 2022;8:eabl8920 pubmed publisher

product information

Product Type :

Antibody

Product Name :

NR3C2 Polyclonal Antibody

Catalog # :

PA5-79761

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Steroid receptors are ligand-dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Mineralocorticoids are a family of steroids, secreted by the adrenal cortex, necessary for the regulation of a number of metabolic processes including electrolyte regulation. These compounds exert their effect through their interaction with the mineralocorticoid receptor (MR) and that complex's subsequent association with DNA. Given the function of mineralocorticoids, it is not surprising to find that the kidney is a primary target organ for mineralocorticoids and that this organ has been shown to contain MR. The corresponding gene for the mineralocorticoid receptor is NR3C2.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK).

Format :

Lyophilized

Applications w/Dilutions :

Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

aldosterone receptor; MCR; Mineralocorticoid receptor; Mineralocorticoid receptor (aldosterone receptor); mineralocorticoid receptor 1; mineralocorticoid receptor 2; mineralocorticoid receptor delta; Mlr; MR; NR3C2; NR3C2VIT; nuclear hormone receptor; nuclear receptor subfamily 3 group C member 2; nuclear receptor subfamily 3, group C, member 2; nuclear receptor subfamily 3, group C, member 2 variant 3