This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
NME1 Polyclonal Antibody
catalog :
PA5-79743
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry
product information
Product Type :
Antibody
Product Name :
NME1 Polyclonal Antibody
Catalog # :
PA5-79743
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL
Aliases :
AL024257; AWD; expressed in non-metastatic cells 1; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; metastasis inhibition factor NM23; NB; NBR-A; NBR-B; NBS; NDK A; NDK A 1; NDK A 2; NDK NBR-A; NDK NBR-B; NDKA; NDP kinase A; NDP kinase A 1; NDP kinase A 2; NDP kinase beta; NDP kinase NBR-A; NDPKA; NDPK-A; NM23; NM23A; NM23-C1; NM23-H1; NM23H1B; nm23-M1; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; nucleoside diphosphate kinase A 1; nucleoside diphosphate kinase A 2; nucleoside diphosphate kinase NBR-B; nucleoside-diphosphate kinase 1; nucleoside-diphosphate kinase NBR-A; nucleotide diphosphate kinase; nucloside diphosphate kinase; tumor metastatic process-associated protein
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments