MUC2 Polyclonal Antibody | Invitrogen PA5-79702 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

MUC2 Polyclonal Antibody

catalog :

PA5-79702

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry, immunohistochemistry - paraffin section

citations: 6

Reference
Jeong H, Hong E, Ahn J, Cho J, Jeong J, Kim C, et al. ERdj5 protects goblet cells from endoplasmic reticulum stress-mediated apoptosis under inflammatory conditions. Exp Mol Med. 2023;55:401-412 pubmed publisher
Paone P, Suriano F, Jian C, Korpela K, Delzenne N, Van Hul M, et al. Prebiotic oligofructose protects against high-fat diet-induced obesity by changing the gut microbiota, intestinal mucus production, glycosylation and secretion. Gut Microbes. 2022;14:2152307 pubmed publisher
Tsang D, Wang R, De Sa O, Ayyaz A, Foerster E, Bayer G, et al. A single cell survey of the microbial impacts on the mouse small intestinal epithelium. Gut Microbes. 2022;14:2108281 pubmed publisher
Steuer A, Scoggin K, Stewart J, Barker V, Adams A, Loynachan A, et al. Comparison of the host response to larvicidal and nonlarvicidal treatment of naturally acquired cyathostomin infections in horses. Parasite Immunol. 2022;44:e12941 pubmed publisher
Gu W, Colarusso J, Dame M, Spence J, Zhou Q. Rapid establishment of human colonic organoid knockout lines. STAR Protoc. 2022;3:101308 pubmed publisher
Leung C, Wadsworth S, Yang S, Dorscheid D. Structural and functional variations in human bronchial epithelial cells cultured in air-liquid interface using different growth media. Am J Physiol Lung Cell Mol Physiol. 2020;318:L1063-L1073 pubmed publisher

product information

Product Type :

Antibody

Product Name :

MUC2 Polyclonal Antibody

Catalog # :

PA5-79702

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 2-5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity. Mucin 2 is the major intestinal mucin. O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogeneous and exogeneous lectins.

Immunogen :

A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 2-5 ug/mL

Aliases :

2010015E03Rik; colonic mucin; HH-Muc; intestinal mucin-2; MCM; MLP; muc2; MUC-2; mucin 2; mucin 2, intestinal/tracheal; mucin 2, oligomeric mucus/gel-forming; mucin-2; mucin-like protein; secreted gel-forming mucin; SMUC; wnn