This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MPP1 Polyclonal Antibody
catalog :
PA5-79692
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
MPP1 Polyclonal Antibody
Catalog # :
PA5-79692
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen :
TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQ
EAF).
A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa
EAF).
A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
55 kDa erythrocyte membrane protein; 55kDa; AAG12; aging-associated gene 12; C130070C03Rik; DXS552E; EMP55; erythrocyte membrane protein p55; LOC652956; membrane palmitoylated protein 1; membrane protein, palmitoylated; membrane protein, palmitoylated 1; membrane protein, palmitoylated 1, 55kDa; migration-related gene 1; MPP1; MRG1; p55; p55 protein; palmitoylated erythrocyte membrane protein; PEMP
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments