This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MMP12 Polyclonal Antibody
catalog :
PA5-79679
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse
application :
western blot, ELISA
product information
Product Type :
Antibody
Product Name :
MMP12 Polyclonal Antibody
Catalog # :
PA5-79679
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Mouse
Applications :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Mouse
Isotype :
IgG
Storage :
-20 C
Description :
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. The gene is part of a cluster of MMP genes which localize to chromosome 11q22. 3.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
3.4.24.65; AV378681; HME; Macrophage elastase; macrophage metalloelastase; macrophage-metalloelastase; matrix metallo protease; matrix metallopeptidase 12; matrix metallopeptidase 12 (macrophage elastase); matrix metalloproteinase 12; matrix metalloproteinase 12 (macrophage elastase); matrix metalloproteinase-12; ME; MGC138506; MME; Mmel; MMP; Mmp12; MMP-12; MMPs
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments