This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MICA Polyclonal Antibody
catalog :
PA5-79671
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
MICA Polyclonal Antibody
Catalog # :
PA5-79671
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
Major histocompatibility complex (MHC) class I proteins are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. A related family, termed the MHC class I chain-related (MIC) proteins are recognized by NKG2D, a receptor on NK and T cells, and promote anti-tumor activity. MICA, a member of the MIC family, is widely expressed on many tumors, and it is the MICA/NKG2D interaction that is thought to stimulate the anti-tumor reactivity by T lymphocytes. Both MICA and MICB mRNA are widely expressed in normal tissues, with MICA being present in virtually every tissue except the nervous system, suggesting that MIC protein expression may only be one component of the anti-tumor activity of the immune system.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
DAMA-345G11.2; HLA class I antigen; MHC class I chain-related protein A; MHC class I polypeptide-related sequence A; MHC class I related sequence A; MICA; MIC-A; PERB11.1; stress inducible class I homolog; truncated MHC class I polypeptide-related sequence A
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments