LIMK1 Polyclonal Antibody | Invitrogen PA5-79603 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

LIMK1 Polyclonal Antibody

catalog :

PA5-79603

quantity :

100 ug

price :

US 410.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

citations: 1

Reference
Zhu Y, Zhang Q, Xie H, Yu K, Xu G, Li S, et al. Environmental enrichment combined with fasudil promotes motor function recovery and axonal regeneration after stroke. Neural Regen Res. 2021;16:2512-2520 pubmed publisher

product information

Product Type :

Antibody

Product Name :

LIMK1 Polyclonal Antibody

Catalog # :

PA5-79603

Quantity :

100 ug

Price :

US 410.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

LIMK1 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK1 has also been implicated in brain development. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR).

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

EC 2.7.11.1; kinase LIMK1; KIZ-1; LIM domain kinase 1; lim kinase 1; LIM motif-containing protein kinase; LIM motif-containing protein kinase 1; LIM-domain containing protein kinase 1; LIM-domain containing, protein kinase; LIM-domain containing, protein kinase 1; Limk; LIMK1; LIMK-1