This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
LGALS3BP Polyclonal Antibody
catalog :
PA5-79597
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
LGALS3BP Polyclonal Antibody
Catalog # :
PA5-79597
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
Immunogen :
A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
90K; basement membrane autoantigen p105; BTBD17B; CyCAP; Cyp-C-associated protein; galectin 3 binding protein; galectin-3-binding protein; gp90; L3 antigen; Lectin; lectin galactoside-binding soluble 3 binding protein; lectin galactoside-binding soluble 3-binding protein; lectin, galactoside binding soluble 3 binding protein; lectin, galactoside-binding, soluble, 3 binding protein; Lgals3bp; M2BP; mac-2 BP; mac-2-binding protein; MAC2BP; MAC-2BP; MAC-2-BP; mama; peptidylprolyl isomerase C-associated protein; Ppicap; Protein 90K; Protein MAMA; serum protein 90K; similar to Galectin-3 binding protein precursor (Lectin galactoside-binding soluble 3 binding protein) (Mac-2 binding protein) (Mac-2 BP) (MAC2BP) (Tumor-associated antigen 90K); TANGO10B; transport and golgi organization 10 homolog B; tumor-associated antigen 90K
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA