This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD171 (L1CAM) Polyclonal Antibody
catalog :
PA5-79573
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CD171 (L1CAM) Polyclonal Antibody
Catalog # :
PA5-79573
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
L1CAM/CD171 is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.
Immunogen :
A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Aliases :
antigen identified by monoclonal antibody R1; CAML1; CD 171; CD171; CD171 molecule; HSAS; HSAS1; Hyd; L1; L1 cell adhesion molecule; L1CAM; MASA; MIC5; N-CAM L1; NCAML1; N-CAML1; N-CAM-L1; NCAM-L1; Nerve-growth factor-inducible large external glycoprotein; neural cell adhesion molecule L1; NILE; S10; sCD171; sL1 CAM; sL1CAM; soluble CD 171; soluble CD171; soluble L1 CAM; soluble L1CAM; SPG1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
