CD171 (L1CAM) Polyclonal Antibody | Invitrogen PA5-79573 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

CD171 (L1CAM) Polyclonal Antibody

catalog :

PA5-79573

quantity :

100 ug

price :

US 400.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

CD171 (L1CAM) Polyclonal Antibody

Catalog # :

PA5-79573

Quantity :

100 ug

Price :

US 400.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

L1CAM/CD171 is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.

Immunogen :

A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Aliases :

antigen identified by monoclonal antibody R1; CAML1; CD 171; CD171; CD171 molecule; HSAS; HSAS1; Hyd; L1; L1 cell adhesion molecule; L1CAM; MASA; MIC5; N-CAM L1; NCAML1; N-CAML1; N-CAM-L1; NCAM-L1; Nerve-growth factor-inducible large external glycoprotein; neural cell adhesion molecule L1; NILE; S10; sCD171; sL1 CAM; sL1CAM; soluble CD 171; soluble CD171; soluble L1 CAM; soluble L1CAM; SPG1