This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
NKG2D (CD314) Polyclonal Antibody
catalog :
PA5-79570
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
NKG2D (CD314) Polyclonal Antibody
Catalog # :
PA5-79570
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. NK cells can regulate specific humoral and cell-mediated immunity, and preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NK gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells.
Immunogen :
(YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKL
VKSYH).
A synthetic peptide corresponding to a sequence of human NKG2D
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA