IL-6 Receptor (CD126) Polyclonal Antibody | Invitrogen PA5-79506 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

IL-6 Receptor (CD126) Polyclonal Antibody

catalog :

PA5-79506

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

citations: 1

Reference
Ma Y, Zhu Y, Shang L, Qiu Y, Shen N, Wang J, et al. LncRNA XIST regulates breast cancer stem cells by activating proinflammatory IL-6/STAT3 signaling. Oncogene. 2023;42:1419-1437 pubmed publisher

product information

Product Type :

Antibody

Product Name :

IL-6 Receptor (CD126) Polyclonal Antibody

Catalog # :

PA5-79506

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human

Isotype :

IgG

Storage :

-20 C

Description :

Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

Immunogen :

LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPER
PR).
A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

CD126; CD126 antigen; gp80; IL-6 Receptor; il-6 receptor alpha; IL-6 receptor alpha chain; IL-6 receptor subunit alpha; IL6Q; IL6R; IL-6R; IL-6R 1; IL-6R subunit alpha; IL6R1; IL-6R-1; Il6ra; IL-6RA; IL-6R-alpha; IL6RQ; ILN; Interleukin; interleukin 6 receptor; interleukin 6 receptor, alpha; interleukin-6 receptor subunit alpha; Membrane glycoprotein 80; MGC104991