This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
IGFBP3 Polyclonal Antibody
catalog :
PA5-79451
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
IGFBP3 Polyclonal Antibody
Catalog # :
PA5-79451
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
ELISA: 0.1-0.5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
IGFBP3 is a gene that belongs to the insulin-like growth factor binding protein (IGFBP) family. The gene encodes a protein that contains both an IGFBP domain and a thyroglobulin type-I domain. This protein is known to form a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. The complex circulates in the plasma and prolongs the half-life of IGFs while also altering their interaction with cell surface receptors. Various isoforms of the gene have been identified through alternate transcriptional splice variants. Diseases associated with IGFBP3 include Insulin-Like Growth Factor I and Acid-Labile Subunit Deficiency.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
acid stable subunit of the 140 K IGF complex; AI649005; binding protein 29; binding protein 53; BP53; BP-53; Growth hormone dependent binding protein; growth hormone-dependent binding protein; I79_011450; IBP3; IBP-3; IGF binding protein 3; IGF-binding protein 3; IGFBP; Igfbp3; IGF-BP3; IGFBP-3; IGgfbp3; Insulin like growth factor binding protein; insulin like growth factor binding protein 3; insulin-like growth factor binding protein 3; Insulin-like growth factor binding protein 3 precursor; insulin-like growth factor-binding protein (IGF-BP3); insulin-like growth factor-binding protein 3; tcag7.703
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA