This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
IGFBP-1 Polyclonal Antibody
catalog :
PA5-79448
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse, rat
application :
western blot, ELISA
product information
Product Type :
Antibody
Product Name :
IGFBP-1 Polyclonal Antibody
Catalog # :
PA5-79448
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Mouse, Rat
Applications :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AFBP; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; hIGFBP 1; hIGFBP1; hIGFBP-1; IBP 1; IBP1; IBP-1; IGF BP25; IGFBA; IGF-binding protein 1; IGFBP; IGFBP 1; Igfbp1; Igfbp-1; IGF-BP25; Insulin like growth factor binding protein; insulin like growth factor binding protein 1; insulin-like growth factor binding protein 1; INSULIN-LIKE GROWTH FACTOR BINDING PROTEIN 1 PRECURSOR (IGFBP-1) (IBP-1) (IGF-BINDING PROTEIN 1); insulin-like growth factor-binding protein 1; Placental protein 12; PP 12; PP12
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
