IDO Polyclonal Antibody | Invitrogen PA5-79437 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

IDO Polyclonal Antibody

catalog :

PA5-79437

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

citations: 1

Reference
Zhao Z, Lu L, Li W. N-(3',4'-dimethoxycinnamonyl) anthranilic acid alleviates severe acute pancreatitis by inhibiting intestinal barrier dysfunction and NF-κB activation. Drug Dev Res. 2021;82:458-464 pubmed publisher

product information

Product Type :

Antibody

Product Name :

IDO Polyclonal Antibody

Catalog # :

PA5-79437

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human

Isotype :

IgG

Storage :

-20 C

Description :

IDO1 is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring of several important regulatory molecules like tryptophan, serotonin, and melatonin. By doing this, IDO1 initiates the production of biologically active metabolites, commonly referred to as kynurenines. IDO1 is widely expressed in a variety of human tissues as well as in macrophages and dendritic cells (DCs). In inflammation, interferons (IFNs) act on specific receptors to trigger IDO1 induction. The production of IFN-gamma and induction of IDO1 represent important antimicrobial mechanisms. Degradation and depletion of tryptophan by IDO1 inhibits the growth of viruses, bacteria and parasites. Furthermore, IDO1 plays a complex and crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and neoplasia.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

EC 1.13.11.52; IDO; IDO1; IDO-1; INDO; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; indoleamine 2,3-dioxygenase 1; indoleamine 23-dioxygenase; Indoleamine-2; indoleamine-pyrrole 2,3 dioxygenase; indoleamine-pyrrole 2,3-dioxygenase