This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ICA1 Polyclonal Antibody
catalog :
PA5-79426
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
ICA1 Polyclonal Antibody
Catalog # :
PA5-79426
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
69 kDa islet cell autoantigen; 69kDa; diabetes mellitus type I autoantigen; ica1; ica1 {ECO:0000312; ICA69; ICAp69; Islet cell autoantigen 1; islet cell autoantigen 1 isoform; islet cell autoantigen 1, 69 kDa; islet cell autoantigen 1, 69kDa; islet cell autoantigen p69; p69; RGD:621465}; testicular tissue protein Li 162; Unknown (protein for MGC:134001); zgc:92566
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments