This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HSPA9 Polyclonal Antibody
catalog :
PA5-79410
quantity :
100 ug
price :
US 434.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
HSPA9 Polyclonal Antibody
Catalog # :
PA5-79410
Quantity :
100 ug
Price :
US 434.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Non-human primate, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Immunoprecipitation: 0.5-2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Non-human primate, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The HSP70 family is composed of four highly conserved proteins: HSP70, HSC70, GRP75 and GRP78. These proteins serve a variety of roles. GRP75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP75 and GRP78 are unresponsive to heat stress and are induced by glucose deprivation.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Immunoprecipitation: 0.5-2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
70 kDa heat shock protein; 74kDa; 75 kDa glucose-regulated protein; C3H-specific antigen; catecholamine-regulated protein 40; CRP40; CSA; epididymis secretory sperm binding protein Li 124m; EVPLS; GRP 75; GRP75; GRP-75; heat shock 70 kDa protein 9; heat shock 70 kDa protein 9B; heat shock 70kD protein 9B; heat shock 70kDa protein 9 (mortalin); heat shock 70kDa protein 9A; heat shock 70kDa protein 9B (mortalin-2); Heat shock protein; heat shock protein 9; heat shock protein 9A; heat shock protein cognate 74; heat shock protein family A (Hsp70) member 9; heat shock protein family A (Hsp70) member 9 S homeolog; heat shock protein, 74 kDa, A; heat shock protein, A; HEL-S-124m; Hsc74; HSP; Hsp74; Hsp74a; hspa9; hspa9.S; Hspa9a; hspa9-a; hspa9b; hspa9-b; hypothetical protein; I79_009139; MGC4500; mortalin; mortalin, perinuclear; mortalin2; mortalin-2; mot; MOT2; Mot-2; Mthsp70; mt-HSP70; MTHSP75; p66 MOT; p66-mortalin; pbp74; Peptide-binding protein 74; RCJMB04_2m8; SAAN; SIDBA4; stress-70 protein mitochondrial-like protein; stress-70 protein, mitochondrial; Stress-70 protein, mitochondrial-like protein; XELAEV_18020021mg
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA