This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HSPA2 Polyclonal Antibody
catalog :
PA5-79408
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
HSPA2 Polyclonal Antibody
Catalog # :
PA5-79408
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
70 kDa heat shock protein; 70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments