This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HPa1 Polyclonal Antibody
catalog :
PA5-79393
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
HPa1 Polyclonal Antibody
Catalog # :
PA5-79393
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Stem cells offer a therapeutic promise for many diseases. In the case of diabetes, stem cells offer the promise that beta cells may be generated ex vivo for the possible transplantation and cure of Type I diabetes (Couri CE, et al. ). For this to happen, stem cells will need to be isolated and expanded, they will need to be differentiated toward the beta cell lineage, and the differentiated cell progeny used for transplantation may need to be isolated from complex cell mixtures following differentiation. Appropriate markers targeting cell surface molecules on developing and mature pancreatic cells will be required for such research.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
Endo-glucoronidase; endoglycosidase heparanase; HEP; Heparanase; Heparanase 50 kDa subunit; Heparanase 8 kDa subunit; Heparanase-1; heparanase-like; Hpa; HPA1; HPR1; HPSE; HPSE1; HSE1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA