This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
HMG4 Polyclonal Antibody
catalog :
PA5-79374
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
HMG4 Polyclonal Antibody
Catalog # :
PA5-79374
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
high mobility group box 3; high mobility group protein 1; high mobility group protein 2a; High mobility group protein 4; high mobility group protein B1; high mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-1; HMG2a; HMG-2a; HMG4; HMG-4; HMGB1; Hmgb3; HMGB3 transcript variant 1/2; MGC90319; RGD1564407; Unknown (protein for MGC:133786)
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments