This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
GRK2 Polyclonal Antibody
catalog :
PA5-79330
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
GRK2 Polyclonal Antibody
Catalog # :
PA5-79330
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
ADRBK1 (GRK2) is a serine/threonine kinase. Many of the G protein-coupled receptors are known to be phosphorylated by G protein-dependent receptor kinases (GRKs). G protein-coupled receptor kinases (GRKs) are important regulators of G protein-coupled receptors(GPCRs). GRK2 (83 kDa), one of six members of this family that have been identified, is ubiquitously expressed in mammals. After binding to their ligand and interacting with heterotrimeric G proteins, GPCRs (e.g., a2-adrenergic receptor) are phosphorylated by GRKs. Internalization of the GPCRs, regulated by beta-arrestin-1, leads to activation of the Ras - Raf - ERK1&2 signaling pathway. GRK2 activity is tightly controlled by different mechanisms including phosphorylation by kinases such as PKC, Src and ERK1&2, as well as interaction with various proteins. ERK phosphorylates and thus inactivates GRK2 on serine 670 in a negative feedback mechanism.
Immunogen :
A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
ADRBK1; Adrbk-1; adrenergic beta receptor kinase 1; adrenergic receptor kinase, beta 1; adrenergic, beta, receptor kinase 1; BARK; BARK1; Bark-1; beta ARK; Beta-adrenergic receptor kinase 1; beta-adrenergic receptor kinase 1 beta ARK1; beta-AR kinase-1; betaARK1; BETA-ARK1; beta-ARK-1; EC 2.7.1.126; G protein-coupled receptor kinase 2; G-protein coupled receptor kinase 2; G-protein-coupled receptor kinase 2; grk 2; Grk2; GRK-2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments