This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
GREM1 Polyclonal Antibody
catalog :
PA5-79324
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
GREM1 Polyclonal Antibody
Catalog # :
PA5-79324
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
In Xenopus, Gremlin belongs to a novel gene family that act as BMP antagonists in embryonic explants. The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13--> q15. DRM-specific mRNA is expressed in different human tissues, including brain, ovary, intestine and colon. It has been suggested that down-regulation of DRM is associated with tumor progression, and support the hypothesis that human DRM may play an important role during both neuroembryological development and carcinogenesis.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
C15DUPq; Cell proliferation-inducing gene 2 protein; CKTSF1B1; colorectal adenoma and carcinoma 1; CRAC1; CRCS4; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; DAND2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; Drm; DUP15q; Grem; GREM1; gremlin; gremlin 1; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1, DAN family BMP antagonist; gremlin 1-like protein; gremlin-1; HMPS; HMPS1; IHG-2; Increased in high glucose protein 2; increased in high glucose-2; ld; MPSH; PIG2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA