GNAQ Polyclonal Antibody | Invitrogen PA5-79318 product information

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

GNAQ Polyclonal Antibody

catalog :

PA5-79318

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, chicken

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

more info or order :

Invitrogen product webpage

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; chicken; 1:2000; fig 4c, 4d	Yang G, Li S, Zhao Q, Chu J, Zhou B, Fan S, et al. Transcriptomic and metabolomic insights into the variety of sperm storage in oviduct of egg layers. Poult Sci. 2021;100:101087 pubmed publisher
	Gupte T, Ritt M, Dysthe M, Malik R, Sivaramakrishnan S. Minute-scale persistence of a GPCR conformation state triggered by non-cognate G protein interactions primes signaling. Nat Commun. 2019;10:4836 pubmed publisher

product information

Product Type :

Antibody

Product Name :

GNAQ Polyclonal Antibody

Catalog # :

PA5-79318

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G alpha q; G protein subunit alpha q; Galpha q; Galphaq; G-ALPHA-q; GAQ; GNAQ; gnaqa; Gq; GqI; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit; si:ch73-270f14.2; SWS

more info or order :

Invitrogen product webpage