This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Connexin 45 Polyclonal Antibody
catalog :
PA5-79311
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
Reference
Wu X, Azizan E, Goodchild E, Garg S, Hagiyama M, Cabrera C, et al. Somatic mutations of CADM1 in aldosterone-producing adenomas and gap junction-dependent regulation of aldosterone production. Nat Genet. 2023;55:1009-1021 pubmed publisher
product information
Product Type :
Antibody
Product Name :
Connexin 45 Polyclonal Antibody
Catalog # :
PA5-79311
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell closely packed transmembrane channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. Connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43. Connexins have four transmembrane, three intracellular, and two extracellular regions. Different tissues express different connexins, though tissue specificities overlap, and a given tissue or cell can express several different connexins. Developmental regulation of at least some of the connexin genes has been found. Embryo implantation is regulated in part by temporally changing patterns of expression of connexins in the embryo and the maternal decidua.
Immunogen :
YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEE
TE).
A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
C130009G16Rik; Cnx45; connexin 45; connexin-45; CTC-296K1.4; CX45; Cxn-45; Gap junction alpha-7 protein; gap junction channel protein connexin 45; gap junction gamma-1 protein; gap junction membrane channel protein alpha 7; gap junction protein gamma 1; gap junction protein, gamma 1; gap junction protein, gamma 1, 45kDa; Gja7; Gja-7; GJC1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA