This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
GFI1 Polyclonal Antibody
catalog :
PA5-79305
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
GFI1 Polyclonal Antibody
Catalog # :
PA5-79305
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The Gfi1 protein expression is regulated by the ubiquitin-proteasome system. It is reported that ubiquitin ligase Triad1 interacts with the DNA-binding domain of Gfi-1. Gfi-1 represses transcription by directly binding to the consensus DNA sequence in the promoters of its target genes. Deficiency of Gfi-1 causes neutropenia and an accumulation of granulomonocytic precursor cells that is reminiscent of a myelodysplastic syndrome in mice.
Immunogen :
A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL
Aliases :
AW495828; FLJ94509; Gfi1; GFI-1; GFI1A; growth factor independence-1; growth factor independent 1; growth factor independent 1 transcription repressor; growth factor independent 1 transcriptional repressor; growth factor independent protein 1; Growth factor independent-1; Pal1; Pal-1; SCN2; Zinc finger protein 163; zinc finger protein Gfi-1; ZNF163
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
