FUS Polyclonal Antibody | Invitrogen PA5-79286 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

FUS Polyclonal Antibody

catalog :

PA5-79286

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

Product Type :

Antibody

Product Name :

FUS Polyclonal Antibody

Catalog # :

PA5-79286

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Immunogen :

A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

16) in malignant liposarcoma); 16) malignant liposarcoma; 75 kDa DNA-pairing protein; ALS6; D430004D17Rik; D930039C12Rik; ETM4; FUS; FUS RNA binding protein; Fus1; fused in sarcoma; fused in sarcoma RNA binding protein; fusion (involved in t(12; fusion gene in myxoid liposarcoma; fusion, derived from t(12; fusion, derived from t(12;16) malignant liposarcoma; fus-like protein; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; HNRNPP2; oncogene FUS; Oncogene TLS; pigpen protein; POMP75; Protein pigpen; RNA-binding protein FUS; TLS; translocated in liposarcoma; translocated in liposarcoma protein