This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
FLT3LG Polyclonal Antibody
catalog :
PA5-79272
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
FLT3LG Polyclonal Antibody
Catalog # :
PA5-79272
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
FLT3LG (Fms Related Tyrosine Kinase 3 Ligand) is a Protein Coding gene. Diseases associated with FLT3LG include Aplastic Anemia and Brain Cancer. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Ras signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and cytokine activity. Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
FL; Flt 3 ligand; Flt3; Flt3 L; Flt3 ligand; Flt3l; Flt3lg; fms related receptor tyrosine kinase 3 ligand; fms related tyrosine kinase 3 ligand; FMS-like tyrosine kinase 3 ligand; fms-related tyrosine kinase 3; fms-related tyrosine kinase 3 ligand; H-FLT-3-L; Ly72L; M-FLT-3-L; NEWGENE_2322792; SL cytokine
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments