This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
FABP5 Polyclonal Antibody
catalog :
PA5-79232
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
FABP5 Polyclonal Antibody
Catalog # :
PA5-79232
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
FABP5 (fatty acid binding protein 5 (psoriasis-associated)) is a proteinthat in humans is encoded by theFABP5 gene, also known as PAFABP, EFABP, E-FABP, KFABP, PA-FABP, Epidermal-type fatty acid-binding protein, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog. It is a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The PAFABP cDNA encodes a 135-amino acid protein with molecular weight 15,164. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated inpsoriasistissue. It is though that FABPs roles include fatty acid uptake, transport, and metabolism. Kaczocha et al. (2009) identifiedFABP5and FABP7 as cytosolic proteins that transport AEA from the plasma membrane to subcellular fatty acid amide hydrolase, where it is hydrolyzed and inactivated. FABP3 did not show this specific transport function.
Immunogen :
A synthetic peptide corresponding to a sequence of mouse FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
C-FABP; Cutaneous fatty acid-binding protein; DA11; EFABP; E-FABP; E-FABPPAFABP; Epidermal-type fatty acid-binding protein; epithelial fatty acid-binding protein; Fabp5; Fabpe; fatty acid binding protein 5; fatty acid binding protein 5 (psoriasis-associated); fatty acid binding protein 5, epidermal; fatty acid-binding protein 5; Fatty acid-binding protein, epidermal; fatty acid-binding protein, epidermal; uncharacterized protein LOC16592; keratinocyte lipid-binding protein; KFABP; Klbp; Mal1; PAFABP; PA-FABP; PA-FABPepidermal; Psoriasis-associated fatty acid-binding protein homolog
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments