This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
FABP4 Polyclonal Antibody
catalog :
PA5-79231
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
FABP4 Polyclonal Antibody
Catalog # :
PA5-79231
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
FABP4 belongs to the fatty acid binding protein (FABP) family. FABPs contribute to the transport of fatty acids and other lipids in various cellular pathways. FABP4 is expressed in adipocytes, macrophages, monocyte-derived dendritic cells, and myoepithelial cells. It delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
3T3-L1 lipid-binding protein; 422/aP2; adipocyte fatty acid binding protein; Adipocyte lipid binding protein; adipocyte lipid-binding protein; adipocyte protein aP2; adipocyte-type fatty acid-binding protein; AFABP; A-FABP; ALBP; ALBP/Ap2; Ap2; epididymis secretory protein Li 104; FABP4; fatty acid binding protein 4; Fatty acid binding protein 4 adipocyte; fatty acid binding protein 4, adipocyte; fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; HEL S 104; HEL-S-104; Lbpl; myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments