This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
FABP2 Polyclonal Antibody
catalog :
PA5-79230
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
FABP2 Polyclonal Antibody
Catalog # :
PA5-79230
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The FABP2 gene encodes the intestinal fatty acid-binding protein 2 (I-FABP), which plays a significant role in lipid metabolism by facilitating the transport and intracellular trafficking of long-chain fatty acids in enterocytes, the absorptive cells in the intestine. FABP2 is involved in the uptake, metabolism, and transfer of fatty acids across cellular membranes, contributing to digestion and absorption processes in the intestine. This protein is crucial for efficient lipid metabolism, influencing fatty acid oxidation, and energy balance. Variations in the FABP2 gene have been associated with metabolic traits, such as insulin sensitivity, lipid profiles, and obesity, suggesting its impact on metabolic health. FABP2's function in intestinal lipid absorption and metabolism makes it a subject of interest in studies related to dietary effects on health and the development of metabolic disorders. Understanding FABP2's role is essential for insights into nutritional influences on health and possible therapeutic targets for metabolic diseases.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK).
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
FABP; Fabp2; Fabpi; fatty acid binding protein 1; fatty acid binding protein 2; fatty acid binding protein 2, intestinal; fatty acid-binding protein 2; Fatty acid-binding protein, intestinal; I-FABP; intestinal fatty acid binding protein; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein; MGC133132
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments