ETV4 Polyclonal Antibody | Invitrogen PA5-79223 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

ETV4 Polyclonal Antibody

catalog :

PA5-79223

quantity :

100 ug

price :

US 400.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot

product information

Product Type :

Antibody

Product Name :

ETV4 Polyclonal Antibody

Catalog # :

PA5-79223

Quantity :

100 ug

Price :

US 400.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Rat

Isotype :

IgG

Storage :

-20 C

Description :

ETV4: ets variant gene 4 (E1A enhancer binding protein, E1AF), also known as PEA3. Several members of the Ets gene family are known to encode sequencespecific DNA binding proteins. These include mouse PU. 1, mouse and human Ets-1, Drosophila E74, chicken and human Ets-2 and rat GABP-a. Each of these proteins recognizes similar motifs in DNA that share a centrally located 5'-GGAA-3' element. For instance, PEA3 binds the motif 5'-AGGAAG-3' (the PEA-3 motif), but does not bind to the sequence 5'-AGGAAC-3', recognized by PU. 1, although PU. 1 binds equally well to both sequences. It appears that all of the Ets proteins recognize the same central core sequence but that each protein interacts with unique sequences that flank this core. PEA3 is expressed at readily detectable levels in cells of epithelial and fibroblastic origin but is not expressed in hematopoietic cells. This is in contrast to other members of the Ets gene family, such as Ets-1, Ets-2 and Fli-1, each of which is expressed primarily in cells of hematopoietic origin.

Immunogen :

MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKL
MD).
A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

Adenovirus E1A enhancer-binding protein; AW414408; E1A F; E1AF; E1A-F; ETS translocation variant 4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ets variant gene 4 (E1A enhancer-binding protein, E1AF); ETS variant protein 4; Etv4; EWS protein/E1A enhancer binding protein chimera; PEA3; Pea-3; PEA3 protein; PEAS3; Polyomavirus enhancer activator 3; POLYOMAVIRUS ENHANCER ACTIVATOR 3 (PEA3 PROTEIN) (ETS TRANSLOCATION VARIANT 4); polyomavirus enhancer activator 3 homolog; polyomavirus enhancer activator-3; Protein PEA3