This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ETS1 Polyclonal Antibody
catalog :
PA5-79222
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
Product Type :
Antibody
Product Name :
ETS1 Polyclonal Antibody
Catalog # :
PA5-79222
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse
Isotype :
IgG
Storage :
-20 C
Description :
ETS1 (c-Ets-1; v-ets erythroblastosis virus E26 oncogene homlog 1 (avian); ETS-1; EWSR2; p54), a 441 A. A protein, is a member of DNA-binding ETS protein family. It is a multifunctional protein consisting of an N-terminal pointed domain, a central transactivation domain and 2 auto inhibitory domains flanked on both sides of conserved C-terminal Ets domain. It interacts with factors including PEBP2alphaA, p300/CBP and mediates transactivation of Osteopontin, Presenilin-1, Stromelysin and Collagenase. It is activated by Ras/MAPK signaling and its expression is up-regulated in resting T-cells. Its activity is modulated by various factors including AP-1, Sp-1, c-myb and MafB. Sp100 activates ETS1 in nuclear bodies. It interacts with EAP1/Daxx and causes repression of MMP1 and BCL2 transactivation. It interacts with STAT6 and modulates Socs-1 expression induced by IL-4. It interacts with GATA3 and positively regulates Tax-1 dependent IL-5 expression.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
AI196000; AI448617; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; avian erythroblastosis virus E26 oncogene 1; c-ets protein; c-ets1; c-ets-1; c-ets-1 oncogene; c-ets-1 protein; c-ets-alpha; c-ets-beta; D230050P06; E26 avian leukemia oncogene 1, 5' domain; Ets avian erythroblastosis virus E2 oncogene homolog 1 (tumor progression locus 1); ets protein; ETS proto-oncogene 1, transcription factor; Ets1; ETS-1; ETS-1A; ETS-1B; Ets-1Delta(III-VI); Etsoncb; EWSR2; FLJ10768; oncoprotein; p54; p54 transcription factor; protein C-ets-1; TNFAIP3 interacting protein 1; TNIP1; Tpl1; transforming protein p54/c-ets-1; transforming protein p68/c-ets-1; tumor progression locus 1; unnamed protein product; v-ets avian erythroblastosis virus E2 oncogene homolog 1; v-ets avian erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1; virion-associated nuclear-shuttling protein
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA