This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
EpCAM (CD326) Polyclonal Antibody
catalog :
PA5-79207
quantity :
100 ug
price :
US 430.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
EpCAM (CD326) Polyclonal Antibody
Catalog # :
PA5-79207
Quantity :
100 ug
Price :
US 430.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
ELISA: 0.1-0.5 ug/mL, Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
Ep-CAM (epithelial adhesion molecule, epithelial specific antigen, ESA) is a transmembrane glycoprotein expressed in the epithelium with a molecular weight of approximately 40 kDa, which functions as an epithelial cell adhesion molecule. Ep-CAM functions as a homotypic calcium-independent cell adhesion molecule, and has a direct impact on cell cycle, proliferation and metabolism of epithelial cells and fibroblasts due to its ability to rapidly induce the proto-oncogene c-myc and the cell cycle regulating genes cyclin A and E. Ep-CAM mediates Ca2+-independent homotypic interactions. Formation of Ep-CAM-mediated adhesions have a negative regulatory effect on adhesions mediated by classic cadherins, which may have strong effects on the differentiation and growth of epithelial cells. Ep-CAM overexpression was suggested to be associated with enhanced epithelial proliferation. Ep-CAM is highly expressed in human carcinomas, and is a marker for tumors of epithelial lineage. Ep-CAM is expressed on baso-lateral cell surface in most simple epithelia and many carcinoma types. Also, Ep-CAM reportedly distinguishes adenocarcinomas from pleural mesotheliomas.
Immunogen :
ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSIL
YENN).
A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa
YENN).
A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
adenocarcinoma-associated antigen; CD326; cell surface glycoprotein Trop-1; DIAR5; EGP; EGP-2; EGP314; EGP40; EPCAM; Ep-CAM; EpCAM1; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; ESA; GA733-2; gp40; hEGP314; HNPCC8; human epithelial glycoprotein-2; KS 1/4 antigen; KS1/4; KSA; Ly74; lymphocyte antigen 74; M1S2; M4S1; major gastrointestinal tumor-associated protein GA733-2; mEGP314; membrane component, chromosome 4, surface marker (35kD glycoprotein); MIC18; MK-1; panepithelial glycoprotein 314; protein 289A; Protein D5.7A; Tacsd1; Tacstd1; TROP1; Trop-1 protein; Tumor-associated calcium signal transducer 1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments