This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ELF1 Polyclonal Antibody
catalog :
PA5-79200
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
ELF1 Polyclonal Antibody
Catalog # :
PA5-79200
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
Immunogen :
A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
E74 like ETS transcription factor 1; E74-like factor 1; E74-like factor 1 (ets domain transcription factor); ELF 1; ELF1; Elf-1; ETS-like transcription factor Elf-1-like protein; ETS-related transcription factor Elf-1; ETS-related transcription factor elf-1-like protein; mElf 1; mElf-1; OTTHUMP00000018310; p70; Sts1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments