This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
DGAT1 Polyclonal Antibody
catalog :
PA5-79150
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
citations: 1
Reference
Godoy Lugo J, Thorwald M, Hui D, Nishiyama A, Nakano D, So xf1 anez Organis J, et al. Chronic angiotensin receptor activation promotes hepatic triacylglycerol accumulation during an acute glucose challenge in obese-insulin-resistant OLETF rats. Endocrine. 2022;75:92-107 pubmed publisher
product information
Product Type :
Antibody
Product Name :
DGAT1 Polyclonal Antibody
Catalog # :
PA5-79150
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The enzyme encoded by this gene utilizes diacylglycerol and fatty acyl CoA as substrates in order to catalyze the final stage of triacylglycerol synthesis. It is also involved in cellular as well as physiological metabolic processes.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
ACAT related gene product 1; ACAT-related gene product 1; Acyl coenzyme A; acyl coenzyme A:cholesterol acyltransferase related gene 1; acyl-CoA retinol O-fatty-acyltransferase; acyl-CoA:diacylglycerol acyltransferase; acyl-coenzyme A:diacylglycerol acyltransferase 1; AGRP1; ARAT; ARGP1; C75990; D15Ertd23e; Dgat; DGAT1; dgat1a; DGAT1B; diacylglycerol acyltransferase; diacylglycerol acyltransferase 1; diacylglycerol O-acyltransferase 1; diacylglycerol O-acyltransferase 1a; diacylglycerol O-acyltransferase homolog 1; diacylglycerol O-acyltransferase homolog 1a; DIAR7; Diglyceride acyltransferase; EC 2.3.1.20; hypothetical protein LOC325875; putative diacylglycerol acyltransferase 1; retinol O-fatty-acyltransferase; wu:fd36g11; zgc:77691
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA