This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CYP2D6 Polyclonal Antibody
catalog :
PA5-79129
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
Reference
Li C, Saliba N, Martin H, Losurdo N, Kolahdouzan K, Siddiqui R, et al. Purkinje cell dopaminergic inputs to astrocytes regulate cerebellar-dependent behavior. Nat Commun. 2023;14:1613 pubmed publisher
product information
Product Type :
Antibody
Product Name :
CYP2D6 Polyclonal Antibody
Catalog # :
PA5-79129
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AI303445; Cholesterol 25-hydroxylase; CPD6; CYP2D; Cyp2d10; Cyp2d-10; Cyp2d13; Cyp2d18; Cyp2d-18; Cyp2d22; Cyp2d3; Cyp2d-3; Cyp2d4; Cyp2d-4; Cyp2d4v1; Cyp2d4v2; Cyp2d6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID10; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D10; cytochrome P450 2d18; Cytochrome P450 2D-29; Cytochrome P450 2D3; cytochrome P450 2D-35; cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450 family 2 subfamily D member 6; cytochrome P450, 2d10; cytochrome P450, family 2, subfamily d, polypeptide 10; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 3; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily d, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; cytochrome P450-16-alpha; Cytochrome P450CB; Cytochrome P450-CMF3; cytochrome P450-DB1; Cytochrome P450-DB3; cytochrome P450-DB4; debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2D-29/2D-35; P450-2D; P450C2D; P450-CMF3; P450DB1; P450-DB1; P450-DB3; P450-DB4; testosterone 16-alpha hydroxylase; xenobiotic monooxygenase
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA