This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CK1 alpha Polyclonal Antibody
catalog :
PA5-79077
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CK1 alpha Polyclonal Antibody
Catalog # :
PA5-79077
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CNSK1A1 (CK1 alpha 1) is a member of the casein kinase I (CKI) gene family, which encodes serine/threonine kinases that preferentially phosphorylate acidic substrates. CKI proteins are monomeric, ranging from 25 to 55 kD, and are found in the nuclei, cytoplasm, and membrane fractions of eukaryotic cells. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2610208K14Rik; 4632404G05Rik; 5430427P18Rik; casein kinase 1 alpha 1; casein kinase 1 alpha 1 like; casein kinase 1 alpha 1 S homeolog; casein kinase 1 alpha 1 S homeolog; casein kinase 1, alpha 1; casein kinase 1 alpha isoform; casein kinase 1, alpha 1; casein kinase 1alpha S; casein kinase 1-alphaL; casein kinase 1-alphaLS; casein kinase I; casein kinase I alpha; casein kinase I alpha L isoform; casein kinase I alpha LS; casein kinase I alpha S; Casein kinase I isoform alpha; casein kinase I isoform alpha; casein kinase I; casein kinase I-alpha; CHUNP6894; CK I alpha; CK1; ck1 alpha; CK1a; ck1alpha; CK1alphaS; CKI alpha; CK-I alpha; CKIa; CKI-alpha; clock regulator kinase; Csnk1a; csnk1a1; CSNK1A1 protein; csnk1a1.S; CSNK1A1/CK1; CSNK1A1L; down-regulated in lung cancer; epididymis secretory sperm binding protein Li 77p; HEL-S-77p; HLCDGP1; OTTHUMP00000224000; OTTHUMP00000224001; OTTHUMP00000224003; PRO2975; protein kinase; sb:eu866; wu:fb65a02; wu:fi30h04; wu:fj19c11; XELAEV_18021437mg; YIL035C; zgc:92158
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA