This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CRY2 Polyclonal Antibody
catalog :
PA5-79073
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CRY2 Polyclonal Antibody
Catalog # :
PA5-79073
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central 'gears' driving this clock appear to be composed of an autoregulatory transcription/post translation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding flavoproteins that bear some homology to blue-light receptors and photolyases. In Drosophila, CRY is a photoreceptor for the circadian clock where it binds to the clock component TIM in a light-dependent fashion and blocks its function. Mammalian CRY1 and CRY2 function via light-independent interactions with circadian genes CLOCK and BMAL1, as well as with PER1, PER2, and TIM. They seem to act as light-independent components of the circadian clock and likely regulate Per1 transcriptional cycling via interactions with both the activator and its feedback inhibitors. Mutant mice not expressing the Cry1 or Cry2 protein display accelerated and delayed periodicity of locomotor activity, respectively. It appears that the combination of both proteins working together is essential to synchronize the organism to circadian phases. A critical balance between Cry1 and Cry2 is required for proper clock function; in complete darkness, double-mutant mice present with instantaneous arrhythmicity, indicating the absence of an internal circadian clock.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AV006279; CRY2; cryptochrome 2 (photolyase-like); cryptochrome circadian clock 2; cryptochrome-2; D130054K12Rik; growth-inhibiting protein 37; HCRY2; Kiaa0658; PHLL2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA