This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
TORC2 Polyclonal Antibody
catalog :
PA5-79072
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
TORC2 Polyclonal Antibody
Catalog # :
PA5-79072
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CRTC2, also known as TORC2 (Transducers Of Regulated cAMP Response Element-Binding (CREB)) 2 and the related protein CRTC1 are potent CREB coactivators that are exported from the nucleus in a CRM1-dependent manner via phosphorylation-dependent interactions. Studies suggest that their phosphorylation and nuclear/cytoplasmic shuttling play an important role in the regulation of gluconeogenesis by cAMP. CRTC2 is present in both B and T-lymphocytes and abundantly expressed in the thymus. Its activity is important in regulating the expression of genes involved in cellular energy metabolism while CRTC1 is essential for energy balance and fertility.
Immunogen :
(EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAY
TR).
A synthetic peptide corresponding to a sequence of human TORC2
TR).
A synthetic peptide corresponding to a sequence of human TORC2
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
4632407F12Rik; CREB regulated transcription coactivator 2; CREB-regulated transcription coactivator 2; CRTC2; mTORC2; OTTHUMP00000035255; RGD1308903; TORC2; TORC-2; transducer of CREB protein 2; transducer of regulated cAMP response element-binding protein (CREB) 2; transducer of regulated cAMP response element-binding protein 2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments